Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLymphocyte differentiation antigen CD38
LigandBDBM50086437
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476003
IC50 13±n/a nM
Citation Haffner CDBecherer JDBoros EECadilla RCarpenter TCowan DDeaton DNGuo YHarrington WHenke BRJeune MRKaldor IMilliken NPetrov KGPreugschat FSchulte CShearer BGShearer TSmalley TLStewart ELStuart JDUlrich JC Discovery, Synthesis, and Biological Evaluation of Thiazoloquin(az)olin(on)es as Potent CD38 Inhibitors. J Med Chem 58:3548-71 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lymphocyte differentiation antigen CD38
Name:Lymphocyte differentiation antigen CD38
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:34333.62
Organism:Homo sapiens (Human)
Description:ChEMBL_1509931
Residue:300
Sequence:
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFP
ETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN
KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDC
SNNPVSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA
WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086437
n/a
NameBDBM50086437
Synonyms:CHEMBL3426038
TypeSmall organic molecule
Emp. Form.C20H23N3O2S
Mol. Mass.369.481
SMILESCO[C@H]1CC[C@@H](CC1)Nc1cc(=O)n(C)c2ccc(cc12)-c1cncs1 |r,wU:2.1,wD:5.8,(6.68,7.38,;6.68,6.15,;5.34,5.38,;5.34,3.84,;4,3.07,;2.67,3.85,;2.68,5.39,;4.01,6.15,;1.33,3.08,;1.33,1.54,;2.66,.77,;2.66,-.77,;3.73,-1.38,;1.33,-1.54,;1.33,-2.77,;,-.77,;-1.33,-1.54,;-2.68,-.77,;-2.68,.77,;-1.33,1.54,;,.77,;-4.01,1.54,;-5.4,.91,;-6.43,2.07,;-5.65,3.39,;-4.14,3.06,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: