Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50130506 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1525487 (CHEMBL3636685) |
---|
IC50 | 703±n/a nM |
---|
Citation | Elkamhawy, A; Viswanath, AN; Pae, AN; Kim, HY; Heo, JC; Park, WK; Lee, CO; Yang, H; Kim, KH; Nam, DH; Seol, HJ; Cho, H; Roh, EJ Discovery of potent and selective cytotoxic activity of new quinazoline-ureas against TMZ-resistant glioblastoma multiforme (GBM). Eur J Med Chem103:210-22 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50130506 |
---|
n/a |
---|
Name | BDBM50130506 |
Synonyms: | CHEMBL3634110 |
Type | Small organic molecule |
Emp. Form. | C26H19FN4O2 |
Mol. Mass. | 438.4531 |
SMILES | Fc1cccc(COc2cc3cncnc3cc2NC(=O)Nc2cccc3ccccc23)c1 |
Structure |
|