Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMyeloperoxidase (MPO)
LigandBDBM50133603
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1526125
Ki 372±n/a nM
Citation Ruggeri RBBuckbinder LBagley SWCarpino PAConn ELDowling MSFernando DPJiao WKung DWOrr STQi YRocke BNSmith AWarmus JSZhang YBowles DWidlicka DWEng HRyder TSharma RWolford AOkerberg CWalters KMaurer TSZhang YBonin PDSpath SNXing GHepworth DAhn KKalgutkar AS Discovery of 2-(6-(5-Chloro-2-methoxyphenyl)-4-oxo-2-thioxo-3,4-dihydropyrimidin-1(2H)-yl)acetamide (PF-06282999): A Highly Selective Mechanism-Based Myeloperoxidase Inhibitor for the Treatment of Cardiovascular Diseases. J Med Chem 58:8513-28 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Myeloperoxidase (MPO)
Name:Myeloperoxidase
Synonyms:84 kDa myeloperoxidase | 89 kDa myeloperoxidase | MPO | Mpo protein | Myeloperoxidase | Myeloperoxidase heavy chain | Myeloperoxidase light chain
Type:Enzyme
Mol. Mass.:83888.32
Organism:Homo sapiens (Human)
Description:P05164
Residue:745
Sequence:
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133603
n/a
NameBDBM50133603
Synonyms:CHEMBL3633248
TypeSmall organic molecule
Emp. Form.C14H15N3O4S
Mol. Mass.321.352
SMILESCOc1ccc(c(OC)c1)-c1cc(=O)[nH]c(=S)n1CC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: