Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTissue-type plasminogen activator
LigandBDBM50153004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1564078
Ki 10500±n/a nM
Citation Corte JRFang TPinto DJOrwat MJRendina ARLuettgen JMRossi KAWei ARamamurthy VMyers JESheriff SNarayanan RHarper TWZheng JJLi YXSeiffert DAWexler RRQuan ML Orally bioavailable pyridine and pyrimidine-based Factor XIa inhibitors: Discovery of the methyl N-phenyl carbamate P2 prime group. Bioorg Med Chem 24:2257-72 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tissue-type plasminogen activator
Name:Tissue-type plasminogen activator
Synonyms:Alteplase | Reteplase | Thrombin receptor protein | Tissue-type plasminogen activator | Tissue-type plasminogen activator (tPA) | Tissue-type plasminogen activator precursor | t-PA | t-Plasminogen Activator (tPA) | t-plasminogen activator
Type:Enzyme
Mol. Mass.:62931.08
Organism:Homo sapiens (Human)
Description:n/a
Residue:562
Sequence:
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153004
n/a
NameBDBM50153004
Synonyms:CHEMBL3781319
TypeSmall organic molecule
Emp. Form.C31H26ClN7O3
Mol. Mass.580.036
SMILESCOC(=O)Nc1ccc(cc1)-c1ccnc(c1)[C@H](Cc1ccccc1)NC(=O)\C=C\c1cc(Cl)ccc1-n1cnnn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: