Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50194756 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1617020 (CHEMBL3859089) |
---|
Ki | 64±n/a nM |
---|
Citation | Shen, Y; Szewczyk, MM; Eram, MS; Smil, D; Kaniskan, HÜ; de Freitas, RF; Senisterra, G; Li, F; Schapira, M; Brown, PJ; Arrowsmith, CH; Barsyte-Lovejoy, D; Liu, J; Vedadi, M; Jin, J Discovery of a Potent, Selective, and Cell-Active Dual Inhibitor of Protein Arginine Methyltransferase 4 and Protein Arginine Methyltransferase 6. J Med Chem59:9124-9139 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50194756 |
---|
n/a |
---|
Name | BDBM50194756 |
Synonyms: | CHEMBL3961701 |
Type | Small organic molecule |
Emp. Form. | C15H24N2O |
Mol. Mass. | 248.3639 |
SMILES | CNCCN1CCC(CC1)OCc1ccccc1 |
Structure |
|