Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50194756
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1617020
Ki 64±n/a nM
Citation Shen YSzewczyk MMEram MSSmil DKaniskan Hde Freitas RFSenisterra GLi FSchapira MBrown PJArrowsmith CHBarsyte-Lovejoy DLiu JVedadi MJin J Discovery of a Potent, Selective, and Cell-Active Dual Inhibitor of Protein Arginine Methyltransferase 4 and Protein Arginine Methyltransferase 6. J Med Chem 59:9124-9139 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma-1 receptor
Synonyms:OPRS1 | SIGMAR1 | Sigma 1-type opioid receptor | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein
Type:Protein
Mol. Mass.:25307.17
Organism:Cavia porcellus (Guinea pig)
Description:Q60492
Residue:223
Sequence:
MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50194756
n/a
NameBDBM50194756
Synonyms:CHEMBL3961701
TypeSmall organic molecule
Emp. Form.C15H24N2O
Mol. Mass.248.3639
SMILESCNCCN1CCC(CC1)OCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: