| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP-sensitive inward rectifier potassium channel 10 |
|---|
| Ligand | BDBM50204281 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1627133 |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Zhu, Y; de Jesus, RK; Tang, H; Walsh, SP; Jiang, J; Gu, X; Teumelsan, N; Shahripour, A; Pio, B; Ding, FX; Ha, S; Priest, BT; Swensen, AM; Alonso-Galicia, M; Felix, JP; Brochu, RM; Bailey, T; Thomas-Fowlkes, B; Zhou, X; Pai, LY; Hampton, C; Hernandez, M; Owens, K; Ehrhart, J; Roy, S; Kaczorowski, GJ; Yang, L; Parmee, ER; Sullivan, K; Garcia, ML; Pasternak, A Discovery of a potent and selective ROMK inhibitor with improved pharmacokinetic properties based on an octahydropyrazino[2,1-c][1,4]oxazine scaffold. Bioorg Med Chem Lett26:5695-5702 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| ATP-sensitive inward rectifier potassium channel 10 |
|---|
| Name: | ATP-sensitive inward rectifier potassium channel 10 |
|---|
| Synonyms: | ATP-dependent inwardly rectifying potassium channel Kir4.1 | Inward rectifier K(+) channel Kir1.2 | KCJ10_HUMAN | KCNJ10 | Potassium channel, inwardly rectifying subfamily J member 10 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 42513.64 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_105175 |
|---|
| Residue: | 379 |
|---|
| Sequence: | MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
|
|
|
|---|
| BDBM50204281 |
|---|
| n/a |
|---|
| Name | BDBM50204281 |
|---|
| Synonyms: | CHEMBL3933749 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23FN8O2 |
|---|
| Mol. Mass. | 462.4795 |
|---|
| SMILES | [H][C@]12CO[C@@H](CN1CCN(C2)C(=O)Cc1ccc(cn1)-n1cnnn1)c1ccc(F)c(C#N)c1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
