Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor
LigandBDBM23954
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1655814
Ki 3700±n/a nM
Citation Tran TAKramer BShin YJVallar PBoatman PDZou NSage CRGharbaoui TKrishnan APal BShakya SRGarrido Montalban AAdams JWRamirez JBehan DPShifrina ABlackburn ALeakakos TShi YMorgan MSadeque AChen WUnett DJGaidarov IChen XChang SShu HHTung SFSemple G Discovery of 2-(((1r,4r)-4-(((4-Chlorophenyl)(phenyl)carbamoyl)oxy)methyl)cyclohexyl)methoxy)acetate (Ralinepag): An Orally Active Prostacyclin Receptor Agonist for the Treatment of Pulmonary Arterial Hypertension. J Med Chem 60:913-927 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor, EP3 subtype | PGE2-R | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor
Type:Enzyme
Mol. Mass.:43335.03
Organism:Homo sapiens (Human)
Description:P43115
Residue:390
Sequence:
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23954
n/a
NameBDBM23954
Synonyms:5-[(2E,3aS,4R,5R,6aS)-5-hydroxy-4-[(1E,3S)-3-hydroxy-4-methyloct-1-en-6-yn-1-yl]-octahydropentalen-2-ylidene]pentanoic acid | CHEMBL494 | ILOPROST | Ventavis | [3H]-Iloprost
Typeradiolabeled ligand
Emp. Form.C22H32O4
Mol. Mass.360.4871
SMILES[H][C@]12C[C@@H](O)[C@H](\C=C\[C@@H](O)C(C)CC#CC)[C@@]1([H])C\C(C2)=C\CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: