Reaction Details |
| Report a problem with these data |
Target | Peptide deformylase |
---|
Ligand | BDBM92762 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Binding Assay |
---|
Ki | 25910±0.0 nM |
---|
Citation | Totoritis, R; Duraiswami, C; Taylor, AN; Kerrigan, JJ; Campobasso, N; Smith, KJ; Ward, P; King, BW; Murrayz-Thompson, M; Jones, AD; Van Aller, GS; Aubart, KM; Zalacain, M; Thrall, SH; Meek, TD; Schwartz, B Understanding the origins of time-dependent inhibition by polypeptide deformylase inhibitors. Biochemistry50:6642-54 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptide deformylase |
---|
Name: | Peptide deformylase |
Synonyms: | DEF_STRR6 | PDF | Polypeptide Deformylase | Polypeptide deformylase (PDF) | def |
Type: | Enzyme |
Mol. Mass.: | 22684.24 |
Organism: | Streptococcus pneumoniae (strain ATCC BAA-255 / R6) |
Description: | The pdf gene from S. pneumoniae was cloned and protein was expressed and purified from E. coli BL21(DE3). |
Residue: | 203 |
Sequence: | MSAIERITKAAHLIDMNDIIREGNPTLRTVAEEVTFPLSDQEIILGEKMMQFLKHSQDPV
MAEKMGLRGGVGLAAPQLDISKRIIAVLVPNIVEEGETPQEAYDLEAIMYNPKIVSHSVQ
DAALGEGEGCLSVDRNVPGYVVRHARVTVDYFDKDGEKHRIKLKGYNSIVVQHEIDHING
IMFYDRINEKDPFAVKDGLLILE
|
|
|
BDBM92762 |
---|
n/a |
---|
Name | BDBM92762 |
Synonyms: | PDF inhibitor, compound 4 |
Type | Small molecule |
Emp. Form. | C11H11Cl2NO3 |
Mol. Mass. | 276.116 |
SMILES | OC(CCNC(=O)c1cccc(Cl)c1Cl)C=O |
Structure |
|