| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM109059 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human Factor D Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | <1000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Wiles, JA; Wang, Q; Gadhachanda, VR; Pais, G; Hashimoto, A; Chen, D; Wang, X; Agarwal, A; Deshpande, M; Phadke, AS Amide compounds for treatment of complement mediated disorders US Patent US9695205 Publication Date 7/4/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM109059 |
|---|
| n/a |
|---|
| Name | BDBM109059 |
|---|
| Synonyms: | US9695205, 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H31ClFN5O4 |
|---|
| Mol. Mass. | 580.05 |
|---|
| SMILES | C[C@@H](NC(=O)[C@@H]1C[C@H]2C[C@H]2N1C(=O)Cn1cc(C(C)=O)c2cc(NC(=O)NC3CC3)ccc12)c1cccc(Cl)c1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
