Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-arginine methyltransferase CARM1
LigandBDBM178101
Substrate/Competitorn/a
Meas. Tech.PRMT Biochemical Assays
Ki>37500±0.0 nM
IC50>75000±0.0 nM
Citation Eram MSShen YSzewczyk MMWu HSenisterra GLi FButler KVKaniskan HÿSpeed BADela Sea CDong AZeng HSchapira MBrown PJArrowsmith CHBarsyte-Lovejoy DLiu JVedadi MJin J A Potent, Selective, and Cell-Active Inhibitor of Human Type I Protein Arginine Methyltransferases. ACS Chem Biol 11:772-81 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-arginine methyltransferase CARM1
Name:Histone-arginine methyltransferase CARM1
Synonyms:CARM1 | Coactivator-associated arginine methyltransferase 1 | Coactivator-associated arginine methyltransferase 1 (CARM1) | Protein arginine N-methyltransferase 4 | Protein arginine methyltransferase 4 (PRMT4)
Type:Protein
Mol. Mass.:65855.47
Organism:Homo sapiens (Human)
Description:n/a
Residue:608
Sequence:
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM178101
n/a
NameBDBM178101
Synonyms:N1-Methyl-N1-((5-(3-(trifluoromethyl)phenyl)-2H-1,2,3-triazol-4-yl)methyl)ethane-1,2-diamine (Compound 1)
TypeSmall organic molecule
Emp. Form.C13H16F3N5
Mol. Mass.299.2948
SMILESCN(CCN)Cc1n[nH]nc1-c1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: