| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H4 receptor |
|---|
| Ligand | BDBM189344 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In vitro [3H]histamine Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 277.15±n/a K |
|---|
| Ki | 3.88e+3±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Latacz, G; Kechagioglou, P; Papi, R; Lazewska, D; Wiecek, M; Kaminska, K; Wencel, P; Karcz, T; Schwed, JS; Stark, H; Kyriakidis, DA; Kiec-Kononowicz, K The Synthesis of 1,3,5-triazine Derivatives and JNJ7777120 Analogues with Histamine H4 Receptor Affinity and Their Interaction with PTEN Promoter. Chem Biol Drug Des88:254-63 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H4 receptor |
|---|
| Name: | Histamine H4 receptor |
|---|
| Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44517.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
|---|
| Residue: | 390 |
|---|
| Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
|---|
| BDBM189344 |
|---|
| n/a |
|---|
| Name | BDBM189344 |
|---|
| Synonyms: | (3-Chlorophenyl)(4-methylpiperazin-1-yl)methanone (2) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H15ClN2O |
|---|
| Mol. Mass. | 238.713 |
|---|
| SMILES | CN1CCN(CC1)C(=O)c1cccc(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
