Reaction Details |
| Report a problem with these data |
Target | Complement factor D |
---|
Ligand | BDBM303059 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
IC50 | <1000±n/a nM |
---|
Citation | Wiles, JA; Phadke, AS; Deshpande, M; Agarwal, A; Chen, D; Gadhachanda, VR; Hashimoto, A; Pais, G; Wang, Q; Wang, X Amino compounds for treatment of medical disorders US Patent US10660876 Publication Date 5/26/2020 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D |
---|
Name: | Complement factor D |
Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
Type: | Protein |
Mol. Mass.: | 27039.19 |
Organism: | Homo sapiens (Human) |
Description: | P00746 |
Residue: | 253 |
Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
BDBM303059 |
---|
n/a |
---|
Name | BDBM303059 |
Synonyms: | (2S,4R)-1-(2-(3- acetyl-5-(pyrimidin-5- ylamino)-1H-indol-1- yl)acetyl)-4-fluoro-N- (1-(1-methyl-1H- pyrazol-3-yl)-2- oxopyrrolidin-3- yl)pyrrolidine-2- carboxamide | US10660876, Cmpd No. 64 | US9598446, Compound 64 |
Type | Small organic molecule |
Emp. Form. | C29H30FN9O4 |
Mol. Mass. | 587.6048 |
SMILES | CC(=O)c1cn(CC(=O)N2C[C@H](F)C[C@H]2C(=O)NC2CCN(C2=O)c2ccn(C)n2)c2ccc(Nc3cncnc3)cc12 |r| |
Structure |
|