| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM354268 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | <1000±n/a nM |
|---|
| Citation |  Wiles, JA; Phadke, AS; Deshpande, M; Agarwal, A; Chen, D; Gadhachanda, VR; Hashimoto, A; Pais, G; Wang, Q; Wang, X Aryl, heteroaryl, and heterocyclic compounds for treatment of medical disorders US Patent US10822352 Publication Date 11/3/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM354268 |
|---|
| n/a |
|---|
| Name | BDBM354268 |
|---|
| Synonyms: | (2S,4R)-1-(2-(3-acetyl- 5-(2-methylpyrimidin- 5-yl)-1H-indazol-1- yl)acetyl)-N-(6- bromopyridin-2-yl)-4- fluoropyrrolidine-2- carboxamide | US10287301, Compound 165 | US10822352, Comp No. 165 | US9796741, cmp No. 165 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23BrFN7O3 |
|---|
| Mol. Mass. | 580.408 |
|---|
| SMILES | CC(=O)c1nn(CC(=O)N2C[C@H](F)C[C@H]2C(=O)Nc2cccc(Br)n2)c2ccc(cc12)-c1cnc(C)nc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
