Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM47908 |
---|
Substrate/Competitor | n/a |
---|
IC50 | 99000±n/a nM |
---|
Citation | Achdout, H; Aimon, A; Bar-David, E; Barr, H; Ben-Shmuel, A; Bennett, J; Boby, ML; Borden, B; Bowman, GR; Brun, J; BVNBS, S; Calmiano, M; Carbery, A; Cattermole, E; Chernyshenko, E; Chodera, JD; Clyde, A; Coffland, JE; Cohen, G; Cole, J; Contini, A; Cox, L; Cvitkovic, M; Dias, A; Donckers, K; Dotson, DL; Douangamath, A; Duberstein, S; Dudgeon, T; Dunnett, L; Eastman, PK; Erez, N; Eyermann, CJ; Fairhead, M; Fate, G; Fearon, D; Fedorov, O; Ferla, M; Fernandes, RS; Ferrins, L; Foster, R; Foster, H; Gabizon, R; Garcia-Sastre, A; Gawriljuk, VO; Gehrtz, P; Gileadi, C; Giroud, C; Glass, WG; Glen, R; Glinert, I; Godoy, AS; Gorichko, M; Gorrie-Stone, T; Griffen, EJ; Hart, SH; Heer, J; Henry, M; Hill, M; Horrell, S; Hurley, MF; Israely, T; Jajack, A; Jnoff, E; Jochmans, D; John, T; Jonghe, SD; Kantsadi, AL; Kenny, PW; Kiappes, JL; Koekemoer, L; Kovar, B; Krojer, T; Lee, AA; Lefker, BA; Levy, H; London, N; Lukacik, P; Macdonald, HB; MacLean, B; Malla, TR; Matviiuk, T; McCorkindale, W; McGovern, BL; Melamed, S; Michurin, O; Mikolajek, H; Milne, BF; Morris, A; Morris, GM; Morwitzer, MJ; Moustakas, D; Nakamura, AM; Neto, JB; Neyts, J; Nguyen, L; Noske, GD; Oleinikovas, V; Oliva, G; Overheul, GJ; Owen, D; Psenak, V; Pai, R; Pan, J; Paran, N; Perry, B; Pingle, M; Pinjari, J; Politi, B; Powell, A; Puni, R; Rangel, VL; Reddi, RN; Reid, SP; Resnick, E; Ripka, EG; Robinson, MC; Robinson, RP; Rodriguez-Guerra, J; Rosales, R; Rufa, D; Schofield, C; Shafeev, M; Shaikh, A; Shi, J; Shurrush, K; Singh, S; Sittner, A; Skyner, R; Smalley, A; Smilova, MD; Solmesky, LJ; Spencer, J; Strain-Damerell, C; Swamy, V; Tamir, H; Tennant, R; Thompson, W; Thompson, A; Thompson, W; Tomasio, S; Tumber, A; Vakonakis, I; van Rij, RP; Vangeel, L; Varghese, FS; Vaschetto, M; Vitner, EB; Voelz, V; Volkamer, A; von Delft, F; von Delft, A; Walsh, M; Ward, W; Weatherall, C; Weiss, S; White, KM; Wild, CF; Wittmann, M; Wright, N; Yahalom-Ronen, Y; Zaidmann, D; Zidane, H; Zitzmann, N Open Science Discovery of Oral Non-Covalent SARS-CoV-2 Main Protease Inhibitor Therapeutics bioRxiv2021:0 (2021) |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
Type: | Enzyme |
Mol. Mass.: | 26557.80 |
Organism: | Homo sapiens (Human) |
Description: | P07477 |
Residue: | 247 |
Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
BDBM47908 |
---|
n/a |
---|
Name | BDBM47908 |
Synonyms: | 2-chloranyl-1-[3-(3,4-dimethoxyphenyl)-5-thiophen-2-yl-3,4-dihydropyrazol-2-yl]ethanone | 2-chloro-1-[3-(3,4-dimethoxyphenyl)-5-thiophen-2-yl-3,4-dihydropyrazol-2-yl]ethanone | 2-chloro-1-[5-(3,4-dimethoxyphenyl)-3-(2-thienyl)-2-pyrazolin-1-yl]ethanone | CVD-0002706 | MAT-POS-916a2c5a-1 | MLS001178292 | SMR000591907 | cid_3811656 |
Type | Small organic molecule |
Emp. Form. | C17H17ClN2O3S |
Mol. Mass. | 364.846 |
SMILES | COc1ccc(cc1OC)C1CC(=NN1C(=O)CCl)c1cccs1 |c:13| |
Structure |
|