Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM21950 |
---|
Substrate/Competitor | BDBM10852 |
---|
Meas. Tech. | Fluorescence Imaging Plate Reader (FLIPR) Assay |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
EC50 | 7.9±n/a nM |
---|
Citation | Li, J; Chen, SY; Li, JJ; Wang, H; Hernandez, AS; Tao, S; Musial, CM; Qu, F; Swartz, S; Chao, ST; Flynn, N; Murphy, BJ; Slusarchyk, DA; Seethala, R; Yan, M; Sleph, P; Grover, G; Smith, MA; Beehler, B; Giupponi, L; Dickinson, KE; Zhang, H; Humphreys, WG; Patel, BP; Schwinden, M; Stouch, T; Cheng, PT; Biller, SA; Ewing, WR; Gordon, D; Robl, JA; Tino, JA Discovery of a tetrazole-based growth hormone secretagogue: 4-(hydroxybutyl)carbamic acid 2-{5-[1-(2-amino-2-methylpropionylamino)-2- benzyloxyethyl]tetrazol-1-yl}ethyl ester (BMS-317180). J Med Chem50:5890-3 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM21950 |
---|
BDBM10852 |
---|
Name | BDBM21950 |
Synonyms: | 2-{5-[(1S)-1-(2-amino-2-methylpropanamido)-2-(benzyloxy)ethyl]-1H-1,2,3,4-tetrazol-1-yl}ethyl N-[2-(3-hydroxyphenyl)ethyl]carbamate | Tetrazole-based compound, 16 |
Type | Small organic molecule |
Emp. Form. | C25H33N7O5 |
Mol. Mass. | 511.5734 |
SMILES | CC(C)(N)C(=O)N[C@H](COCc1ccccc1)c1nnnn1CCOC(=O)NCCc1cccc(O)c1 |r| |
Structure |
|