Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Oxysterols receptor LXR-alpha [197-447] |
---|
Ligand | BDBM26070 |
---|
Substrate/Competitor | BDBM19993 |
---|
Meas. Tech. | LXR Binding Assay and hLXR Reporter Assay |
---|
IC50 | 401±n/a nM |
---|
EC50 | 12770±n/a nM |
---|
Citation | Wrobel, J; Steffan†, R; Bowen, SM; Magolda, R; Matelan†, E; Unwalla†, R; Basso, M; Clerin, V; Gardell, SJ; Nambi, P; Quinet, E; Reminick, JI; Vlasuk, GP; Wang, S; Feingold, I; Huselton, C; Bonn, T Indazole-Based Liver X Receptor (LXR) Modulators with Maintained Atherosclerotic Lesion Reduction Activity but Diminished Stimulation of Hepatic Triglyceride Synthesis J Med Chem51:7161-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Oxysterols receptor LXR-alpha [197-447] |
---|
Name: | Oxysterols receptor LXR-alpha [197-447] |
Synonyms: | LXRA | Liver X Receptor alpha (LXR-alpha) | NR1H3 | NR1H3_HUMAN | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha |
Type: | Receptor |
Mol. Mass.: | 28986.41 |
Organism: | Homo sapiens (Human) |
Description: | LXR alpha ligand binding domain (amino acid residues 197-447) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays. |
Residue: | 251 |
Sequence: | SSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAH
FTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFL
KDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLP
PLLSEIWDVHE
|
|
|
BDBM26070 |
---|
BDBM19993 |
---|
Name | BDBM26070 |
Synonyms: | 2-[(4-chlorophenyl)methyl]-3-(4-fluorophenyl)-7-(trifluoromethyl)-2H-indazole | 2-benzyl-3-aryl-7-trifluoromethylindazole, 16 |
Type | Small organic molecule |
Emp. Form. | C21H13ClF4N2 |
Mol. Mass. | 404.788 |
SMILES | Fc1ccc(cc1)-c1n(Cc2ccc(Cl)cc2)nc2c(cccc12)C(F)(F)F |
Structure |
|