| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50267119 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1701992 (CHEMBL4053225) |
|---|
| EC50 | >33000±n/a nM |
|---|
| Citation |  Jurica, EA; Wu, X; Williams, KN; Hernandez, AS; Nirschl, DS; Rampulla, RA; Mathur, A; Zhou, M; Cao, G; Xie, C; Jacob, B; Cai, H; Wang, T; Murphy, BJ; Liu, H; Xu, C; Kunselman, LK; Hicks, MB; Sun, Q; Schnur, DM; Sitkoff, DF; Dierks, EA; Apedo, A; Moore, DB; Foster, KA; Cvijic, ME; Panemangalore, R; Flynn, NA; Maxwell, BD; Hong, Y; Tian, Y; Wilkes, JJ; Zinker, BA; Whaley, JM; Barrish, JC; Robl, JA; Ewing, WR; Ellsworth, BA Discovery of Pyrrolidine-Containing GPR40 Agonists: Stereochemistry Effects a Change in Binding Mode. J Med Chem60:1417-1431 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1_MOUSE | Ffar1 | Gpr40 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31818.80 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1454431 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP
LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
|
|
|
|---|
| BDBM50267119 |
|---|
| n/a |
|---|
| Name | BDBM50267119 |
|---|
| Synonyms: | CHEMBL1532576 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H15Cl2NO4 |
|---|
| Mol. Mass. | 380.222 |
|---|
| SMILES | OC(=O)C1CN(C(=O)C1)c1ccc(OCc2ccc(Cl)cc2Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
