Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50267119 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1701992 (CHEMBL4053225) |
---|
EC50 | >33000±n/a nM |
---|
Citation | Jurica, EA; Wu, X; Williams, KN; Hernandez, AS; Nirschl, DS; Rampulla, RA; Mathur, A; Zhou, M; Cao, G; Xie, C; Jacob, B; Cai, H; Wang, T; Murphy, BJ; Liu, H; Xu, C; Kunselman, LK; Hicks, MB; Sun, Q; Schnur, DM; Sitkoff, DF; Dierks, EA; Apedo, A; Moore, DB; Foster, KA; Cvijic, ME; Panemangalore, R; Flynn, NA; Maxwell, BD; Hong, Y; Tian, Y; Wilkes, JJ; Zinker, BA; Whaley, JM; Barrish, JC; Robl, JA; Ewing, WR; Ellsworth, BA Discovery of Pyrrolidine-Containing GPR40 Agonists: Stereochemistry Effects a Change in Binding Mode. J Med Chem60:1417-1431 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1_MOUSE | Ffar1 | Gpr40 |
Type: | PROTEIN |
Mol. Mass.: | 31818.80 |
Organism: | Mus musculus |
Description: | ChEMBL_1454431 |
Residue: | 300 |
Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLGCSDLLLAITLP
LKAVEALASGAWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
RYSWGVCVAIWALVLCHLGLALGLETSGSWLDNSTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVRSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLGGSWRKLGLITGAWSVVLNPLVTGYLGTGPGRGTICVTRTQRGTIQK
|
|
|
BDBM50267119 |
---|
n/a |
---|
Name | BDBM50267119 |
Synonyms: | CHEMBL1532576 |
Type | Small organic molecule |
Emp. Form. | C18H15Cl2NO4 |
Mol. Mass. | 380.222 |
SMILES | OC(=O)C1CN(C(=O)C1)c1ccc(OCc2ccc(Cl)cc2Cl)cc1 |
Structure |
|