Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50478379 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_479606 (CHEMBL926802) |
---|
IC50 | 5.2±n/a nM |
---|
Citation | Tucker, TJ; Saggar, S; Sisko, JT; Tynebor, RM; Williams, TM; Felock, PJ; Flynn, JA; Lai, MT; Liang, Y; McGaughey, G; Liu, M; Miller, M; Moyer, G; Munshi, V; Perlow-Poehnelt, R; Prasad, S; Sanchez, R; Torrent, M; Vacca, JP; Wan, BL; Yan, Y The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations. Bioorg Med Chem Lett18:2959-66 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50478379 |
---|
n/a |
---|
Name | BDBM50478379 |
Synonyms: | CHEMBL401809 |
Type | Small organic molecule |
Emp. Form. | C21H11Cl3N2O2S |
Mol. Mass. | 461.748 |
SMILES | Clc1cc(Oc2cc(OCc3nc4cccc(Cl)c4s3)ccc2Cl)cc(c1)C#N |
Structure |
|