| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50478388 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_479605 (CHEMBL926801) |
|---|
| IC50 | 7.3±n/a nM |
|---|
| Citation |  Tucker, TJ; Saggar, S; Sisko, JT; Tynebor, RM; Williams, TM; Felock, PJ; Flynn, JA; Lai, MT; Liang, Y; McGaughey, G; Liu, M; Miller, M; Moyer, G; Munshi, V; Perlow-Poehnelt, R; Prasad, S; Sanchez, R; Torrent, M; Vacca, JP; Wan, BL; Yan, Y The design and synthesis of diaryl ether second generation HIV-1 non-nucleoside reverse transcriptase inhibitors (NNRTIs) with enhanced potency versus key clinical mutations. Bioorg Med Chem Lett18:2959-66 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50478388 |
|---|
| n/a |
|---|
| Name | BDBM50478388 |
|---|
| Synonyms: | CHEMBL255468 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H12Cl3N3O2 |
|---|
| Mol. Mass. | 444.698 |
|---|
| SMILES | Clc1cc(Oc2cc(OCc3nc4cccc(Cl)c4[nH]3)ccc2Cl)cc(c1)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
