| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM50125717 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_51874 (CHEMBL666529) |
|---|
| IC50 | 590±n/a nM |
|---|
| Citation |  Wu, YQ; Belyakov, S; Choi, C; Limburg, D; Thomas IV, BE; Vaal, M; Wei, L; Wilkinson, DE; Holmes, A; Fuller, M; McCormick, J; Connolly, M; Moeller, T; Steiner, J; Hamilton, GS Synthesis and biological evaluation of non-peptidic cyclophilin ligands. J Med Chem46:1112-5 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | Cyclophilin A | PPIA_RAT | Ppia |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17878.16 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_51874 |
|---|
| Residue: | 164 |
|---|
| Sequence: | MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL
|
|
|
|---|
| BDBM50125717 |
|---|
| n/a |
|---|
| Name | BDBM50125717 |
|---|
| Synonyms: | 1-{2,4-Dibromo-5-[3-(4-iodo-phenyl)-ureido]-phenyl}-3-(4-iodo-phenyl)-urea | CHEMBL417253 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H14Br2I2N4O2 |
|---|
| Mol. Mass. | 755.968 |
|---|
| SMILES | Brc1cc(Br)c(NC(=O)Nc2ccc(I)cc2)cc1NC(=O)Nc1ccc(I)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
