Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase A |
---|
Ligand | BDBM50125724 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_51874 (CHEMBL666529) |
---|
IC50 | 2120.0±n/a nM |
---|
Citation | Wu, YQ; Belyakov, S; Choi, C; Limburg, D; Thomas IV, BE; Vaal, M; Wei, L; Wilkinson, DE; Holmes, A; Fuller, M; McCormick, J; Connolly, M; Moeller, T; Steiner, J; Hamilton, GS Synthesis and biological evaluation of non-peptidic cyclophilin ligands. J Med Chem46:1112-5 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase A |
Synonyms: | Cyclophilin A | PPIA_RAT | Ppia |
Type: | PROTEIN |
Mol. Mass.: | 17878.16 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_51874 |
Residue: | 164 |
Sequence: | MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL
|
|
|
BDBM50125724 |
---|
n/a |
---|
Name | BDBM50125724 |
Synonyms: | 3,5-Dichloro-N-{3-[3-(2-methyl-benzyl)-ureido]-phenyl}-benzamide | CHEMBL13519 |
Type | Small organic molecule |
Emp. Form. | C22H19Cl2N3O2 |
Mol. Mass. | 428.311 |
SMILES | Cc1ccccc1CNC(=O)Nc1cccc(NC(=O)c2cc(Cl)cc(Cl)c2)c1 |
Structure |
|