Reaction Details |
| Report a problem with these data |
Target | Stimulator of interferon genes protein |
---|
Ligand | BDBM50584871 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2160786 (CHEMBL5045536) |
---|
IC50 | 50±n/a nM |
---|
Citation | Cherney, EC; Zhang, L; Lo, J; Huynh, T; Wei, D; Ahuja, V; Quesnelle, C; Schieven, GL; Futran, A; Locke, GA; Lin, Z; Monereau, L; Chaudhry, C; Blum, J; Li, S; Fereshteh, M; Li-Wang, B; Gangwar, S; Pan, C; Chong, C; Zhu, X; Posy, SL; Sack, JS; Zhang, P; Ruzanov, M; Harner, M; Akhtar, F; Schroeder, GM; Vite, G; Fink, B Discovery of Non-Nucleotide Small-Molecule STING Agonists J Med Chem65:3518-3538 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Stimulator of interferon genes protein |
---|
Name: | Stimulator of interferon genes protein |
Synonyms: | Endoplasmic reticulum interferon stimulator | Eris | MMITA | Mediator of IRF3 activation | Mita | Mpys | STING_MOUSE | Stimulator of interferon genes protein | Sting | Sting1 | Synonyms=Eris | Tmem173 | Transmembrane protein 173 | mSTING |
Type: | PROTEIN |
Mol. Mass.: | 42834.49 |
Organism: | Mus musculus |
Description: | ChEMBL_119061 |
Residue: | 378 |
Sequence: | MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLL
KNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMF
GLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRM
FNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYS
NSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILED
VPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEP
RLLISGMDQPLPLRTDLI
|
|
|
BDBM50584871 |
---|
n/a |
---|
Name | BDBM50584871 |
Synonyms: | CHEMBL5080916 |
Type | Small organic molecule |
Emp. Form. | C18H10ClN5O5 |
Mol. Mass. | 411.756 |
SMILES | Clc1cc2cc(CNC(=O)c3cnn4cccnc34)oc2c2c1oc(=O)[nH]c2=O |
Structure |
|