Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50600763 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2234794 (CHEMBL5148566) |
---|
IC50 | 26300±n/a nM |
---|
Citation | Zhang, H; Ginn, J; Zhan, W; Liu, YJ; Leung, A; Toita, A; Okamoto, R; Wong, TT; Imaeda, T; Hara, R; Yukawa, T; Michino, M; Vendome, J; Beuming, T; Sato, K; Aso, K; Meinke, PT; Nathan, CF; Kirkman, LA; Lin, G Design, Synthesis, and Optimization of Macrocyclic Peptides as Species-Selective Antimalaria Proteasome Inhibitors. J Med Chem65:9350-9375 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50600763 |
---|
n/a |
---|
Name | BDBM50600763 |
Synonyms: | CHEMBL5194112 | US20240043470, Compound 1-56 |
Type | Small organic molecule |
Emp. Form. | C34H35F3N4O5 |
Mol. Mass. | 636.6607 |
SMILES | FC(F)(F)CNC(=O)[C@@H]1Cc2cccc(Oc3cccc(C[C@H](N4CCCC4=O)C(=O)N[C@@H](CCc4ccccc4)C(=O)N1)c3)c2 |r| |
Structure |
|