Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM50615821 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2304418 |
---|
EC50 | 640±n/a nM |
---|
Citation | Cadilla, R; Deaton, DN; Do, Y; Elkins, PA; Ennulat, D; Guss, JH; Holt, J; Jeune, MR; King, AG; Klapwijk, JC; Kramer, HF; Kramer, NJ; Laffan, SB; Masuria, PI; McDougal, AV; Mortenson, PN; Musetti, C; Peckham, GE; Pietrak, BL; Poole, C; Price, DJ; Rendina, AR; Sati, G; Saxty, G; Shearer, BG; Shewchuk, LM; Sneddon, HF; Stewart, EL; Stuart, JD; Thomas, DN; Thomson, SA; Ward, P; Wilson, JW; Xu, T; Youngman, MA The exploration of aza-quinolines as hematopoietic prostaglandin D synthase (H-PGDS) inhibitors with low brain exposure. Bioorg Med Chem28:0 (2020) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | 2.5.1.18 | 5.3.99.2 | GST class-sigma | Glutathione S-transferase | Glutathione-dependent PGD synthase | Glutathione-requiring prostaglandin D synthase | Gsts | H-PGDS | HPGDS_RAT | Hematopoietic prostaglandin D synthase | Hpgds | Pgds | Prostaglandin-H2 D-isomerase | Ptgds2 |
Type: | PROTEIN |
Mol. Mass.: | 23295.19 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_118881 |
Residue: | 199 |
Sequence: | MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLT
LHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMSLFPWAEENQDLKERTFNDLL
TRQAPHLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNK
VQAIPAISAWILKRPQTKL
|
|
|
BDBM50615821 |
---|
n/a |
---|
Name | BDBM50615821 |
Synonyms: | CHEMBL5282999 |
Type | Small organic molecule |
Emp. Form. | C16H16N4O2 |
Mol. Mass. | 296.3238 |
SMILES | O=C(N[C@H]1CCNC1=O)c1cnc2nc(ccc2c1)C1CC1 |r| |
Structure |
|