Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50415671 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_622562 (CHEMBL1117506) |
---|
EC50 | >10000±n/a nM |
---|
Citation | Bailey, JM; Scott, JS; Basilla, JB; Bolton, VJ; Boyfield, I; Evans, DG; Fleury, E; Heightman, TD; Jarvie, EM; Lawless, K; Matthews, KL; McKay, F; Mok, H; Muir, A; Orlek, BS; Sanger, GJ; Stemp, G; Stevens, AJ; Thompson, M; Ward, J; Vaidya, K; Westaway, SM The discovery and optimisation of benzazepine sulfonamide and sulfones as potent agonists of the motilin receptor. Bioorg Med Chem Lett19:6452-8 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50415671 |
---|
n/a |
---|
Name | BDBM50415671 |
Synonyms: | CHEMBL1078104 |
Type | Small organic molecule |
Emp. Form. | C20H21ClN4O2S |
Mol. Mass. | 416.924 |
SMILES | Clc1ccc(cc1)S(=O)(=O)Nc1ccc2CCN(Cc3ccn[nH]3)CCc2c1 |
Structure |
|