Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Appetite-regulating hormone |
---|
Ligand | BDBM50359248 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_790253 (CHEMBL1925646) |
---|
Ki | 56±n/a nM |
---|
Citation | Hoveyda, HR; Marsault, E; Gagnon, R; Mathieu, AP; Vézina, M; Landry, A; Wang, Z; Benakli, K; Beaubien, S; Saint-Louis, C; Brassard, M; Pinault, JF; Ouellet, L; Bhat, S; Ramaseshan, M; Peng, X; Foucher, L; Beauchemin, S; Bhérer, P; Veber, DF; Peterson, ML; Fraser, GL Optimization of the potency and pharmacokinetic properties of a macrocyclic ghrelin receptor agonist (Part I): Development of ulimorelin (TZP-101) from hit to clinic. J Med Chem54:8305-20 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Appetite-regulating hormone |
---|
Name: | Appetite-regulating hormone |
Synonyms: | GHRL | GHRL_HUMAN | Ghrelin | Ghrelin-27 | Ghrelin-28 | Growth hormone secretagogue | Growth hormone-releasing peptide | MTLRP | Motilin-related peptide | Obestatin | Protein M46 |
Type: | PROTEIN |
Mol. Mass.: | 12908.57 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_790253 |
Residue: | 117 |
Sequence: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
|
|
|
BDBM50359248 |
---|
n/a |
---|
Name | BDBM50359248 |
Synonyms: | CHEMBL1923638 |
Type | Small organic molecule |
Emp. Form. | C30H39FN4O4 |
Mol. Mass. | 538.6535 |
SMILES | C[C@H]1CN[C@@H](C2CC2)C(=O)N(C)[C@H](C)C(=O)N[C@H](Cc2ccc(F)cc2)C(=O)NCCCc2ccccc2O1 |r| |
Structure |
|