| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50033883 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1435799 (CHEMBL3389554) |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Famiglini, V; La Regina, G; Coluccia, A; Pelliccia, S; Brancale, A; Maga, G; Crespan, E; Badia, R; Riveira-Muñoz, E; Esté, JA; Ferretti, R; Cirilli, R; Zamperini, C; Botta, M; Schols, D; Limongelli, V; Agostino, B; Novellino, E; Silvestri, R Indolylarylsulfones carrying a heterocyclic tail as very potent and broad spectrum HIV-1 non-nucleoside reverse transcriptase inhibitors. J Med Chem57:9945-57 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50033883 |
|---|
| n/a |
|---|
| Name | BDBM50033883 |
|---|
| Synonyms: | CHEMBL1766221 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21ClN2O3S |
|---|
| Mol. Mass. | 452.953 |
|---|
| SMILES | Cc1cc(C)cc(c1)S(=O)(=O)c1c([nH]c2ccc(Cl)cc12)C(=O)NCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
