| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hematopoietic prostaglandin D synthase |
|---|
| Ligand | BDBM50615784 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2304418 |
|---|
| EC50 | 110±n/a nM |
|---|
| Citation |  Cadilla, R; Deaton, DN; Do, Y; Elkins, PA; Ennulat, D; Guss, JH; Holt, J; Jeune, MR; King, AG; Klapwijk, JC; Kramer, HF; Kramer, NJ; Laffan, SB; Masuria, PI; McDougal, AV; Mortenson, PN; Musetti, C; Peckham, GE; Pietrak, BL; Poole, C; Price, DJ; Rendina, AR; Sati, G; Saxty, G; Shearer, BG; Shewchuk, LM; Sneddon, HF; Stewart, EL; Stuart, JD; Thomas, DN; Thomson, SA; Ward, P; Wilson, JW; Xu, T; Youngman, MA The exploration of aza-quinolines as hematopoietic prostaglandin D synthase (H-PGDS) inhibitors with low brain exposure. Bioorg Med Chem28:0 (2020) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hematopoietic prostaglandin D synthase |
|---|
| Name: | Hematopoietic prostaglandin D synthase |
|---|
| Synonyms: | 2.5.1.18 | 5.3.99.2 | GST class-sigma | Glutathione S-transferase | Glutathione-dependent PGD synthase | Glutathione-requiring prostaglandin D synthase | Gsts | H-PGDS | HPGDS_RAT | Hematopoietic prostaglandin D synthase | Hpgds | Pgds | Prostaglandin-H2 D-isomerase | Ptgds2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 23295.19 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_118881 |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLT
LHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMSLFPWAEENQDLKERTFNDLL
TRQAPHLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNK
VQAIPAISAWILKRPQTKL
|
|
|
|---|
| BDBM50615784 |
|---|
| n/a |
|---|
| Name | BDBM50615784 |
|---|
| Synonyms: | CHEMBL5284902 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H17N5O2 |
|---|
| Mol. Mass. | 311.3385 |
|---|
| SMILES | O=C(N[C@H]1CCNC1=O)c1cnc2cc(ncc2c1)N1CCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
