Reaction Details |
| Report a problem with these data |
Target | Tryptase beta-2 |
---|
Ligand | BDBM14300 |
---|
Substrate/Competitor | BDBM12679 |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 25000±n/a nM |
---|
Citation | McGrath, ME; Sprengeler, PA; Hirschbein, B; Somoza, JR; Lehoux, I; Janc, JW; Gjerstad, E; Graupe, M; Estiarte, A; Venkataramani, C; Liu, Y; Yee, R; Ho, JD; Green, MJ; Lee, CS; Liu, L; Tai, V; Spencer, J; Sperandio, D; Katz, BA Structure-guided design of peptide-based tryptase inhibitors. Biochemistry45:5964-73 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tryptase beta-2 |
---|
Name: | Tryptase beta-2 |
Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
Type: | PROTEIN |
Mol. Mass.: | 30518.79 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_210702 |
Residue: | 275 |
Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
BDBM14300 |
---|
BDBM12679 |
---|
Name | BDBM14300 |
Synonyms: | benzthiazole analog 3 | benzyl N-[(2S,4E)-6-amino-1-(1,3-benzothiazol-2-yl)-1-oxohex-4-en-2-yl]carbamate |
Type | Small organic molecule |
Emp. Form. | C21H21N3O3S |
Mol. Mass. | 395.475 |
SMILES | NCCCCC(=NC(=O)OCc1ccccc1)C(=O)c1nc2ccccc2s1 |w:6.6| |
Structure |
|