| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tryptase beta-2 |
|---|
| Ligand | BDBM14320 |
|---|
| Substrate/Competitor | BDBM12679 |
|---|
| Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
|---|
| Ki | 390000±n/a nM |
|---|
| Citation |  McGrath, ME; Sprengeler, PA; Hirschbein, B; Somoza, JR; Lehoux, I; Janc, JW; Gjerstad, E; Graupe, M; Estiarte, A; Venkataramani, C; Liu, Y; Yee, R; Ho, JD; Green, MJ; Lee, CS; Liu, L; Tai, V; Spencer, J; Sperandio, D; Katz, BA Structure-guided design of peptide-based tryptase inhibitors. Biochemistry45:5964-73 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tryptase beta-2 |
|---|
| Name: | Tryptase beta-2 |
|---|
| Synonyms: | TPS2 | TPSB2 | TRYB2_HUMAN | Tryptase | Tryptase II | Tryptase beta-1 | Tryptase-2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30518.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_210702 |
|---|
| Residue: | 275 |
|---|
| Sequence: | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
|
|
|
|---|
| BDBM14320 |
|---|
| BDBM12679 |
|---|
| Name | BDBM14320 |
|---|
| Synonyms: | 1-amino-isoquinoline | CHEMBL62083 | Fragment 17 | fragment 1 (J. med. chem.,50,1116) | isoquinolin-1-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H8N2 |
|---|
| Mol. Mass. | 144.1732 |
|---|
| SMILES | Nc1nccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
