Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein kinase Lck [245-498] |
---|
Ligand | BDBM14951 |
---|
Substrate/Competitor | Gastrin Peptide Substrate |
---|
Meas. Tech. | Homogeneous Time-Resolved Fluorescence (HTRF) Enzyme Assay |
---|
IC50 | 19±n/a nM |
---|
Citation | Cee, VJ; Albrecht, BK; Geuns-Meyer, S; Hughes, P; Bellon, S; Bready, J; Caenepeel, S; Chaffee, SC; Coxon, A; Emery, M; Fretland, J; Gallant, P; Gu, Y; Hodous, BL; Hoffman, D; Johnson, RE; Kendall, R; Kim, JL; Long, AM; McGowan, D; Morrison, M; Olivieri, PR; Patel, VF; Polverino, A; Powers, D; Rose, P; Wang, L; Zhao, H Alkynylpyrimidine amide derivatives as potent, selective, and orally active inhibitors of Tie-2 kinase. J Med Chem50:627-40 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tyrosine-protein kinase Lck [245-498] |
---|
Name: | Tyrosine-protein kinase Lck [245-498] |
Synonyms: | LCK | LCK_HUMAN | LSK | Lymphocyte cell-specific protein-tyrosine kinase | Proto-oncogene tyrosine-protein kinase LCK | T cell-specific protein-tyrosine kinase | p56-LCK |
Type: | Kinase domain |
Mol. Mass.: | 29166.29 |
Organism: | Homo sapiens (Human) |
Description: | Recombinant kinase domain (amino acid 245 to 498) fused with GST tag. |
Residue: | 254 |
Sequence: | LKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLY
AVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRD
LRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVW
SFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDR
PTFDYLRSVLEDFF
|
|
|
BDBM14951 |
---|
Gastrin Peptide Substrate |
---|
Name: | Gastrin Peptide Substrate |
Synonyms: | Biotinylated gastrin peptide substrate | biotinylated gastrin substrate | gastrin substrate |
Type: | Peptide |
Mol. Mass.: | 1823.88 |
Organism: | n/a |
Description: | n/a |
Residue: | 15 |
Sequence: | |