Reaction Details |
| Report a problem with these data |
Target | Oxysterols receptor LXR-alpha [197-447] |
---|
Ligand | BDBM20012 |
---|
Substrate/Competitor | BDBM19993 |
---|
Meas. Tech. | LXR Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 277.15±n/a K |
---|
IC50 | 104±n/a nM |
---|
Citation | Hu, B; Jetter, J; Kaufman, D; Singhaus, R; Bernotas, R; Unwalla, R; Quinet, E; Savio, D; Halpern, A; Basso, M; Keith, J; Clerin, V; Chen, L; Liu, QY; Feingold, I; Huselton, C; Azam, F; Goos-Nilsson, A; Wilhelmsson, A; Nambi, P; Wrobel, J Further modification on phenyl acetic acid based quinolines as liver X receptor modulators. Bioorg Med Chem15:3321-33 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Oxysterols receptor LXR-alpha [197-447] |
---|
Name: | Oxysterols receptor LXR-alpha [197-447] |
Synonyms: | LXRA | Liver X Receptor alpha (LXR-alpha) | NR1H3 | NR1H3_HUMAN | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha |
Type: | Receptor |
Mol. Mass.: | 28986.41 |
Organism: | Homo sapiens (Human) |
Description: | LXR alpha ligand binding domain (amino acid residues 197-447) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays. |
Residue: | 251 |
Sequence: | SSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAH
FTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFL
KDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLP
PLLSEIWDVHE
|
|
|
BDBM20012 |
---|
BDBM19993 |
---|
Name | BDBM20012 |
Synonyms: | 2-[4-({[3-(3-benzoyl-8-fluoroquinolin-4-yl)phenyl]amino}methyl)phenyl]acetic acid | phenyl acetic acid based quinoline, 24 |
Type | Small organic molecule |
Emp. Form. | C31H23FN2O3 |
Mol. Mass. | 490.5243 |
SMILES | OC(=O)Cc1ccc(CNc2cccc(c2)-c2c(cnc3c(F)cccc23)C(=O)c2ccccc2)cc1 |
Structure |
|