Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 14 |
---|
Ligand | BDBM20662 |
---|
Substrate/Competitor | myelin basic protein |
---|
Meas. Tech. | In Vitro Enzyme Inhibition Assay and Cell-based TNFalpha Biosynthesis Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 13±n/a nM |
---|
EC50 | 120±n/a nM |
---|
Citation | Hynes, J; Dyckman, AJ; Lin, S; Wrobleski, ST; Wu, H; Gillooly, KM; Kanner, SB; Lonial, H; Loo, D; McIntyre, KW; Pitt, S; Shen, DR; Shuster, DJ; Yang, X; Zhang, R; Behnia, K; Zhang, H; Marathe, PH; Doweyko, AM; Tokarski, JS; Sack, JS; Pokross, M; Kiefer, SE; Newitt, JA; Barrish, JC; Dodd, J; Schieven, GL; Leftheris, K Design, synthesis, and anti-inflammatory properties of orally active 4-(phenylamino)-pyrrolo[2,1-f][1,2,4]triazine p38alpha mitogen-activated protein kinase inhibitors. J Med Chem51:4-16 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Mitogen-activated protein kinase 14 |
---|
Name: | Mitogen-activated protein kinase 14 |
Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 41286.76 |
Organism: | Homo sapiens (Human) |
Description: | Q16539 |
Residue: | 360 |
Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
BDBM20662 |
---|
myelin basic protein |
---|
Name: | myelin basic protein |
Synonyms: | myelin A1 protein |
Type: | Other Protein Type |
Mol. Mass.: | 4541.90 |
Organism: | Oryctolagus cuniculus (rabbit) |
Description: | n/a |
Residue: | 42 |
Sequence: | fgsdrgapkr gsgkdhaart thygslpqks ghrpqdenpv vh
|
|
|