| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Growth hormone secretagogue receptor type 1 |
|---|
| Ligand | BDBM21948 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | Fluorescence Imaging Plate Reader (FLIPR) Assay |
|---|
| pH | 7.2±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| EC50 | 82.5±n/a nM |
|---|
| Citation |  Li, J; Chen, SY; Li, JJ; Wang, H; Hernandez, AS; Tao, S; Musial, CM; Qu, F; Swartz, S; Chao, ST; Flynn, N; Murphy, BJ; Slusarchyk, DA; Seethala, R; Yan, M; Sleph, P; Grover, G; Smith, MA; Beehler, B; Giupponi, L; Dickinson, KE; Zhang, H; Humphreys, WG; Patel, BP; Schwinden, M; Stouch, T; Cheng, PT; Biller, SA; Ewing, WR; Gordon, D; Robl, JA; Tino, JA Discovery of a tetrazole-based growth hormone secretagogue: 4-(hydroxybutyl)carbamic acid 2-{5-[1-(2-amino-2-methylpropionylamino)-2- benzyloxyethyl]tetrazol-1-yl}ethyl ester (BMS-317180). J Med Chem50:5890-3 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Growth hormone secretagogue receptor type 1 |
|---|
| Name: | Growth hormone secretagogue receptor type 1 |
|---|
| Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 41334.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
|---|
| Residue: | 366 |
|---|
| Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
|---|
| BDBM21948 |
|---|
| BDBM10852 |
|---|
| Name | BDBM21948 |
|---|
| Synonyms: | 2-{5-[(1S)-1-(2-amino-2-methylpropanamido)-2-(benzyloxy)ethyl]-1H-1,2,3,4-tetrazol-1-yl}ethyl N-(4-acetamidobutyl)carbamate | Tetrazole-based compound, 14 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H36N8O5 |
|---|
| Mol. Mass. | 504.5825 |
|---|
| SMILES | CC(=O)NCCCCNC(=O)OCCn1nnnc1[C@@H](COCc1ccccc1)NC(=O)C(C)(C)N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
