| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metallo-beta-lactamase type 2 |
|---|
| Ligand | BDBM262973 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Class B Enzyme Assay |
|---|
| pH | 7±n/a |
|---|
| IC50 | 0.491±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Mandal, M; Tang, H; Xiao, L; Su, J; Li, G; Yang, S; Pan, W; Tang, H; DeJesus, R; Hicks, J; Lombardo, M; Chu, H; Hagmann, W; Pasternak, A; Gu, X; Jiang, J; Dong, S; Ding, F; London, C; Biswas, D; Young, K; Hunter, DN; Zhao, Z; Yang, D Metallo-beta-lactamase inhibitors US Patent US9708336 Publication Date 7/18/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metallo-beta-lactamase type 2 |
|---|
| Name: | Metallo-beta-lactamase type 2 |
|---|
| Synonyms: | B2 metallo-beta-lactamase | BLAN1_KLEPN | Beta-lactamase NDM-1 | Beta-lactamase type II | Metallo-beta-lactamase NDM-1 | Metallo-beta-lactamase type 2 | Metallo-beta-lactamase type II | NDM-1 | New Delhi metallo-beta-lactamase-1 | blaNDM-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28498.15 |
|---|
| Organism: | Klebsiella pneumoniae |
|---|
| Description: | ChEMBL_103887 |
|---|
| Residue: | 270 |
|---|
| Sequence: | MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ
HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH
AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF
PKASMIVMSHSAPDSRAAITHTARMADKLR
|
|
|
|---|
| BDBM262973 |
|---|
| n/a |
|---|
| Name | BDBM262973 |
|---|
| Synonyms: | 9-[3-sulfamoyl-2-(1H-tetrazol-5-yl)- 4-(trifluoromethyl)phenyl]-3- azaspiro[5.5]undecane-3- carboxamidine | US9708336, 826 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25F3N8O2S |
|---|
| Mol. Mass. | 486.514 |
|---|
| SMILES | NC(=N)N1CCC2(CCC(CC2)c2ccc(c(c2-c2nnn[nH]2)S(N)(=O)=O)C(F)(F)F)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
