| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peroxisome proliferator-activated receptor alpha |
|---|
| Ligand | BDBM28699 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | Cell-Based Transcription Assay |
|---|
| EC50 | 55000±n/a nM |
|---|
| Citation |  Sierra, ML; Beneton, V; Boullay, AB; Boyer, T; Brewster, AG; Donche, F; Forest, MC; Fouchet, MH; Gellibert, FJ; Grillot, DA; Lambert, MH; Laroze, A; Le Grumelec, C; Linget, JM; Montana, VG; Nguyen, VL; Nicodème, E; Patel, V; Penfornis, A; Pineau, O; Pohin, D; Potvain, F; Poulain, G; Ruault, CB; Saunders, M; Toum, J; Xu, HE; Xu, RX; Pianetti, PM Substituted 2-[(4-aminomethyl)phenoxy]-2-methylpropionic acid PPARalpha agonists. 1. Discovery of a novel series of potent HDLc raising agents. J Med Chem50:685-95 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Peroxisome proliferator-activated receptor alpha |
|---|
| Name: | Peroxisome proliferator-activated receptor alpha |
|---|
| Synonyms: | NR1C1 | Nuclear receptor subfamily 1 group C member 1 | PPAR | PPAR alpha/gamma | PPAR-alpha | PPARA | PPARA_HUMAN | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor | Peroxisome proliferator-activated receptor alpha (PPAR alpha) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 52222.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q07869 |
|---|
| Residue: | 468 |
|---|
| Sequence: | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
|
|---|
| BDBM28699 |
|---|
| BDBM10852 |
|---|
| Name | BDBM28699 |
|---|
| Synonyms: | 2-(4-chlorophenoxy)-2-methylpropanoic acid | CHEMBL683 | Clofibrate | Clofibrinic acid | clofibric acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H11ClO3 |
|---|
| Mol. Mass. | 214.646 |
|---|
| SMILES | CC(C)(Oc1ccc(Cl)cc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
