Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM34003 |
---|
Substrate/Competitor | BDBM34002 |
---|
Meas. Tech. | Pin1 Enzymatic Activity Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 288.15±n/a K |
---|
Ki | 1700±n/a nM |
---|
Citation | Guo, C; Hou, X; Dong, L; Dagostino, E; Greasley, S; Ferre, R; Marakovits, J; Johnson, MC; Matthews, D; Mroczkowski, B; Parge, H; Vanarsdale, T; Popoff, I; Piraino, J; Margosiak, S; Thomson, J; Los, G; Murray, BW Structure-based design of novel human Pin1 inhibitors (I). Bioorg Med Chem Lett19:5613-6 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM34003 |
---|
BDBM34002 |
---|
Name | BDBM34003 |
Synonyms: | pipecolate deriv., 11 |
Type | Small organic molecule |
Emp. Form. | C26H35N2O7P |
Mol. Mass. | 518.5391 |
SMILES | OP(O)(=O)OC[C@@H](Cc1ccccc1)NC(=O)N1CCCC[C@H]1C(=O)OCCCCc1ccccc1 |r| |
Structure |
|