| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B10 |
|---|
| Ligand | BDBM50241826 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1670539 (CHEMBL4020427) |
|---|
| IC50 | 7.5±n/a nM |
|---|
| Citation |  Endo, S; Xia, S; Suyama, M; Morikawa, Y; Oguri, H; Hu, D; Ao, Y; Takahara, S; Horino, Y; Hayakawa, Y; Watanabe, Y; Gouda, H; Hara, A; Kuwata, K; Toyooka, N; Matsunaga, T; Ikari, A Synthesis of Potent and Selective Inhibitors of Aldo-Keto Reductase 1B10 and Their Efficacy against Proliferation, Metastasis, and Cisplatin Resistance of Lung Cancer Cells. J Med Chem60:8441-8455 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B10 |
|---|
| Name: | Aldo-keto reductase family 1 member B10 |
|---|
| Synonyms: | AK1BA_HUMAN | AKR1B10 | AKR1B11 | ARL-1 | ARP | Aldo-keto reductase family 1 member B10 | Aldo-keto reductase family 1 member B10 (AKR1B10) | Aldo-keto reductase family member 1B10 (AKR1B10) | Aldose reductase-like | Aldose reductase-related protein | SI reductase | Small intestine reductase | hARP |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 36024.67 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O60218. 1ZUA; 4JII; 4GQ0 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
|
|
|
|---|
| BDBM50241826 |
|---|
| n/a |
|---|
| Name | BDBM50241826 |
|---|
| Synonyms: | CHEMBL4089816 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H24N2O5 |
|---|
| Mol. Mass. | 444.4792 |
|---|
| SMILES | COc1ccc(cc1)\N=c1/oc2cc(O)ccc2cc1C(=O)NCCCc1cccc(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
