Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member C1 |
---|
Ligand | BDBM50241817 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1670544 (CHEMBL4020432) |
---|
IC50 | 950±n/a nM |
---|
Citation | Endo, S; Xia, S; Suyama, M; Morikawa, Y; Oguri, H; Hu, D; Ao, Y; Takahara, S; Horino, Y; Hayakawa, Y; Watanabe, Y; Gouda, H; Hara, A; Kuwata, K; Toyooka, N; Matsunaga, T; Ikari, A Synthesis of Potent and Selective Inhibitors of Aldo-Keto Reductase 1B10 and Their Efficacy against Proliferation, Metastasis, and Cisplatin Resistance of Lung Cancer Cells. J Med Chem60:8441-8455 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member C1 |
---|
Name: | Aldo-keto reductase family 1 member C1 |
Synonyms: | 20-alpha-HSD | 20-alpha-Hydroxysteroid Dehydrogenase (AKR1C1) | AK1C1_HUMAN | AKR1C1 | Aldo-keto reductase family 1 member C1 (AK1C1) | Aldo-keto reductase family 1 member C1 (AK1C1a) | Aldo-keto reductase family 1 member C1 (AKR1C1) | Chlordecone reductase homolog HAKRC | DDH | DDH1 | High-affinity hepatic bile acid-binding protein | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 36793.97 |
Organism: | Homo sapiens (Human) |
Description: | Recombinant AKR1C1 enzyme was expressed in E. coli. |
Residue: | 323 |
Sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
|
|
|
BDBM50241817 |
---|
n/a |
---|
Name | BDBM50241817 |
Synonyms: | CHEMBL4081954 |
Type | Small organic molecule |
Emp. Form. | C19H17NO5 |
Mol. Mass. | 339.342 |
SMILES | Oc1ccc(CCCNC(=O)c2cc3ccc(O)cc3oc2=O)cc1 |
Structure |
|