Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50004182 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_63655 |
---|
pH | 7.5±n/a |
---|
IC50 | 57.0±n/a nM |
---|
Comments | extracted |
---|
Citation | Skiles, JW; Miao, C; Sorcek, R; Jacober, S; Mui, PW; Chow, G; Weldon, SM; Possanza, G; Skoog, M; Keirns, J Inhibition of human leukocyte elastase by N-substituted peptides containing alpha,alpha-difluorostatone residues at P1. J Med Chem35:4795-808 (1993) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50004182 |
---|
n/a |
---|
Name | BDBM50004182 |
Synonyms: | 2-Acetylamino-6-(4-{2-[(2-benzyloxycarbonylamino-3-methyl-butyryl)-indan-2-yl-amino]-acetylamino}-2,2-difluoro-5-methyl-3-oxo-hexanoylamino)-hexanoic acid methyl ester | CHEMBL143049 |
Type | Small organic molecule |
Emp. Form. | C40H53F2N5O9 |
Mol. Mass. | 785.8737 |
SMILES | COC(=O)[C@H](CCCCNC(=O)C(F)(F)C(=O)C(NC(=O)CN(C1Cc2ccccc2C1)C(=O)C(NC(=O)OCc1ccccc1)C(C)C)C(C)C)NC(C)=O |
Structure |
|