Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50458672 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1764478 (CHEMBL4199725) |
---|
Ki | 3.4±n/a nM |
---|
Citation | Huang, X; Brubaker, J; Zhou, W; Biju, PJ; Xiao, L; Shao, N; Huang, Y; Dong, L; Liu, Z; Bitar, R; Buevich, A; Jung, J; Peterson, SL; Butcher, JW; Close, J; Martinez, M; MacCoss, RN; Zhang, H; Crawford, S; McCormick, KD; Aslanian, R; Nargund, R; Correll, C; Gervais, F; Qiu, H; Yang, X; Garlisi, C; Rindgen, D; Maloney, KM; Siliphaivanh, P; Palani, A Discovery of MK-8318, a Potent and Selective CRTh2 Receptor Antagonist for the Treatment of Asthma. ACS Med Chem Lett9:679-684 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50458672 |
---|
n/a |
---|
Name | BDBM50458672 |
Synonyms: | CHEMBL4203572 |
Type | Small organic molecule |
Emp. Form. | C27H25ClF4N2O5 |
Mol. Mass. | 568.944 |
SMILES | [H][C@@]12CCC[C@]1([H])N(C(=O)c1ccc(OC(F)(F)F)cc1)c1cc(Cl)c(F)cc1[C@@H]2N(C1CC1)C(=O)CCC(O)=O |r| |
Structure |
|