| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50058983 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_34106 (CHEMBL649735) |
|---|
| IC50 | 3700±n/a nM |
|---|
| Citation |  Niwata, S; Fukami, H; Sumida, M; Ito, A; Kakutani, S; Saitoh, M; Suzuki, K; Imoto, M; Shibata, H; Imajo, S; Kiso, Y; Tanaka, T; Nakazato, H; Ishihara, T; Takai, S; Yamamoto, D; Shiota, N; Miyazaki, M; Okunishi, H; Kinoshita, A; Urata, H; Arakawa, K Substituted 3-(phenylsulfonyl)-1-phenylimidazolidine-2,4-dione derivatives as novel nonpeptide inhibitors of human heart chymase. J Med Chem40:2156-63 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50058983 |
|---|
| n/a |
|---|
| Name | BDBM50058983 |
|---|
| Synonyms: | 3-(3-Methoxy-benzenesulfonyl)-1-phenyl-imidazolidine-2,4-dione | CHEMBL65936 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H14N2O5S |
|---|
| Mol. Mass. | 346.358 |
|---|
| SMILES | COc1cccc(c1)S(=O)(=O)N1C(=O)CN(C1=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
