Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50058996 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_34106 (CHEMBL649735) |
---|
IC50 | 4000±n/a nM |
---|
Citation | Niwata, S; Fukami, H; Sumida, M; Ito, A; Kakutani, S; Saitoh, M; Suzuki, K; Imoto, M; Shibata, H; Imajo, S; Kiso, Y; Tanaka, T; Nakazato, H; Ishihara, T; Takai, S; Yamamoto, D; Shiota, N; Miyazaki, M; Okunishi, H; Kinoshita, A; Urata, H; Arakawa, K Substituted 3-(phenylsulfonyl)-1-phenylimidazolidine-2,4-dione derivatives as novel nonpeptide inhibitors of human heart chymase. J Med Chem40:2156-63 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50058996 |
---|
n/a |
---|
Name | BDBM50058996 |
Synonyms: | 3-(4-Chloro-benzenesulfonyl)-1-(3,4-dichloro-phenyl)-imidazolidine-2,4-dione | CHEMBL305800 |
Type | Small organic molecule |
Emp. Form. | C15H9Cl3N2O4S |
Mol. Mass. | 419.667 |
SMILES | Clc1ccc(cc1)S(=O)(=O)N1C(=O)CN(C1=O)c1ccc(Cl)c(Cl)c1 |
Structure |
|