| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Somatostatin receptor type 1 |
|---|
| Ligand | BDBM155921 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1924574 (CHEMBL4427530) |
|---|
| IC50 | 2630±n/a nM |
|---|
| Citation |  Tang, H; Zhu, Y; Teumelsan, N; Walsh, SP; Shahripour, A; Priest, BT; Swensen, AM; Felix, JP; Brochu, RM; Bailey, T; Thomas-Fowlkes, B; Pai, LY; Hampton, C; Corona, A; Hernandez, M; Metzger, J; Forrest, M; Zhou, X; Owens, K; Tong, V; Parmee, E; Roy, S; Kaczorowski, GJ; Yang, L; Alonso-Galicia, M; Garcia, ML; Pasternak, A Discovery of MK-7145, an Oral Small Molecule ROMK Inhibitor for the Treatment of Hypertension and Heart Failure. ACS Med Chem Lett7:697-701 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Somatostatin receptor type 1 |
|---|
| Name: | Somatostatin receptor type 1 |
|---|
| Synonyms: | SOMATOSTATIN SST1 | SRIF-2 | SS-1-R | SS1-R | SS1R | SSR1_HUMAN | SSTR1 | Somatostatin receptor type 1 (SSTR1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42692.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30872 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
|
|
|
|---|
| BDBM155921 |
|---|
| n/a |
|---|
| Name | BDBM155921 |
|---|
| Synonyms: | US9018211, 2A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H30N2O6 |
|---|
| Mol. Mass. | 466.5262 |
|---|
| SMILES | Cc1c2COC(=O)c2ccc1[C@@H](O)CN1CCN(C[C@H](O)c2ccc3C(=O)OCc3c2C)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
