Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 3 |
---|
Ligand | BDBM258466 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2080915 (CHEMBL4736706) |
---|
EC50 | >1000±n/a nM |
---|
Citation | Gilmore, JL; Xiao, HY; Dhar, TGM; Yang, M; Xiao, Z; Yang, X; Taylor, TL; McIntyre, KW; Warrack, BM; Shi, H; Levesque, PC; Marino, AM; Cornelius, G; Mathur, A; Shen, DR; Pang, J; Cvijic, ME; Lehman-McKeeman, LD; Sun, H; Xie, J; Salter-Cid, L; Carter, PH; Dyckman, AJ Bicyclic Ligand-Biased Agonists of S1P J Med Chem64:1454-1480 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 3 |
---|
Name: | Sphingosine 1-phosphate receptor 3 |
Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 42278.13 |
Organism: | Homo sapiens (Human) |
Description: | Q99500 |
Residue: | 378 |
Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
BDBM258466 |
---|
n/a |
---|
Name | BDBM258466 |
Synonyms: | US9522888, 689 |
Type | Small organic molecule |
Emp. Form. | C22H36NO5P |
Mol. Mass. | 425.4987 |
SMILES | COCCCCC[C@@H]1CCc2cc(ccc2C1)[C@H]1CC[C@](N)(COP(O)(O)=O)C1 |r| |
Structure |
|