| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 4 |
|---|
| Ligand | BDBM23163 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2080916 (CHEMBL4736707) |
|---|
| EC50 | 1.6±n/a nM |
|---|
| Citation |  Gilmore, JL; Xiao, HY; Dhar, TGM; Yang, M; Xiao, Z; Yang, X; Taylor, TL; McIntyre, KW; Warrack, BM; Shi, H; Levesque, PC; Marino, AM; Cornelius, G; Mathur, A; Shen, DR; Pang, J; Cvijic, ME; Lehman-McKeeman, LD; Sun, H; Xie, J; Salter-Cid, L; Carter, PH; Dyckman, AJ Bicyclic Ligand-Biased Agonists of S1P J Med Chem64:1454-1480 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 4 |
|---|
| Name: | Sphingosine 1-phosphate receptor 4 |
|---|
| Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41647.39 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 384 |
|---|
| Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
|---|
| BDBM23163 |
|---|
| n/a |
|---|
| Name | BDBM23163 |
|---|
| Synonyms: | CHEMBL114606 | FTY720-phosphate, rac-2 | {2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy}phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H34NO5P |
|---|
| Mol. Mass. | 387.4507 |
|---|
| SMILES | CCCCCCCCc1ccc(CCC(N)(CO)COP(O)(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
