Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 4 |
---|
Ligand | BDBM50169441 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2080916 (CHEMBL4736707) |
---|
EC50 | 11±n/a nM |
---|
Citation | Gilmore, JL; Xiao, HY; Dhar, TGM; Yang, M; Xiao, Z; Yang, X; Taylor, TL; McIntyre, KW; Warrack, BM; Shi, H; Levesque, PC; Marino, AM; Cornelius, G; Mathur, A; Shen, DR; Pang, J; Cvijic, ME; Lehman-McKeeman, LD; Sun, H; Xie, J; Salter-Cid, L; Carter, PH; Dyckman, AJ Bicyclic Ligand-Biased Agonists of S1P J Med Chem64:1454-1480 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 4 |
---|
Name: | Sphingosine 1-phosphate receptor 4 |
Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41647.39 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 384 |
Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
BDBM50169441 |
---|
n/a |
---|
Name | BDBM50169441 |
Synonyms: | CHEMBL3806205 |
Type | Small organic molecule |
Emp. Form. | C22H36NO4P |
Mol. Mass. | 409.4993 |
SMILES | CCCCCC[C@@H]1CCc2cc(ccc2C1)[C@H]1CC[C@](N)(COP(O)(O)=O)C1 |r| |
Structure |
|