Reaction Details |
| Report a problem with these data |
Target | C-C chemokine receptor type 5 |
---|
Ligand | BDBM50410168 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_305950 (CHEMBL832790) |
---|
IC50 | 0.42±n/a nM |
---|
Citation | Kim, D; Wang, L; Hale, JJ; Lynch, CL; Budhu, RJ; Maccoss, M; Mills, SG; Malkowitz, L; Gould, SL; DeMartino, JA; Springer, MS; Hazuda, D; Miller, M; Kessler, J; Hrin, RC; Carver, G; Carella, A; Henry, K; Lineberger, J; Schleif, WA; Emini, EA Potent 1,3,4-trisubstituted pyrrolidine CCR5 receptor antagonists: effects of fused heterocycles on antiviral activity and pharmacokinetic properties. Bioorg Med Chem Lett15:2129-34 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-C chemokine receptor type 5 |
---|
Name: | C-C chemokine receptor type 5 |
Synonyms: | C-C CKR-5 | C-C chemokine receptor type 5 | CC-CKR-5 | CCR-5 | CCR5 | CCR5/mu opioid receptor complex | CCR5_HUMAN | CD_antigen=CD195 | CHEMR13 | CMKBR5 | HIV-1 fusion coreceptor |
Type: | Enzyme |
Mol. Mass.: | 40540.21 |
Organism: | Homo sapiens (Human) |
Description: | P51681 |
Residue: | 352 |
Sequence: | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
|
|
|
BDBM50410168 |
---|
n/a |
---|
Name | BDBM50410168 |
Synonyms: | CHEMBL2113086 |
Type | Small organic molecule |
Emp. Form. | C30H37FN4O2 |
Mol. Mass. | 504.6388 |
SMILES | OC(=O)[C@@H](CC1CCC1)N1C[C@H](CN2CCC(CC2)c2cnc3ccccn23)[C@H](C1)c1cccc(F)c1 |
Structure |
|