Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM50133009 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_325600 (CHEMBL860282) |
---|
Ki | 32±n/a nM |
---|
Citation | Venable, JD; Cai, H; Chai, W; Dvorak, CA; Grice, CA; Jablonowski, JA; Shah, CR; Kwok, AK; Ly, KS; Pio, B; Wei, J; Desai, PJ; Jiang, W; Nguyen, S; Ling, P; Wilson, SJ; Dunford, PJ; Thurmond, RL; Lovenberg, TW; Karlsson, L; Carruthers, NI; Edwards, JP Preparation and biological evaluation of indole, benzimidazole, and thienopyrrole piperazine carboxamides: potent human histamine h(4) antagonists. J Med Chem48:8289-98 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM50133009 |
---|
n/a |
---|
Name | BDBM50133009 |
Synonyms: | (4-Bromo-1H-indol-2-yl)-(4-methyl-piperazin-1-yl)-methanone | (4-bromo-1H-indol-2-yl)(4-methylpiperazin-1-yl)methanone | CHEMBL128505 |
Type | Small organic molecule |
Emp. Form. | C14H16BrN3O |
Mol. Mass. | 322.2 |
SMILES | CN1CCN(CC1)C(=O)c1cc2c(Br)cccc2[nH]1 |
Structure |
|