| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50600764 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2234794 (CHEMBL5148566) |
|---|
| IC50 | 2400±n/a nM |
|---|
| Citation |  Zhang, H; Ginn, J; Zhan, W; Liu, YJ; Leung, A; Toita, A; Okamoto, R; Wong, TT; Imaeda, T; Hara, R; Yukawa, T; Michino, M; Vendome, J; Beuming, T; Sato, K; Aso, K; Meinke, PT; Nathan, CF; Kirkman, LA; Lin, G Design, Synthesis, and Optimization of Macrocyclic Peptides as Species-Selective Antimalaria Proteasome Inhibitors. J Med Chem65:9350-9375 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50600764 |
|---|
| n/a |
|---|
| Name | BDBM50600764 |
|---|
| Synonyms: | CHEMBL5182017 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H37F3N4O5 |
|---|
| Mol. Mass. | 602.6445 |
|---|
| SMILES | FC(F)(F)CNC(=O)[C@@H]1CCCCOc2cccc(C[C@H](N3CCCC3=O)C(=O)N[C@@H](CCc3ccccc3)C(=O)N1)c2 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
